DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kots and tag-250

DIOPT Version :10

Sequence 1:NP_650324.1 Gene:Kots / 41702 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_001021188.2 Gene:tag-250 / 176113 WormBaseID:WBGene00016203 Length:626 Species:Caenorhabditis elegans


Alignment Length:57 Identity:14/57 - (24%)
Similarity:22/57 - (38%) Gaps:16/57 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HCVFQLHINMKFLSTILILSCIPLIQCWSCGEGKITEGLAWIIALPTETKSINKCCE 60
            :|:.:..|      |.|..:|.||     |.:...::|  ..|.|....|.   ||:
 Worm    35 YCIVECSI------TFLDDACKPL-----CIDRGYSDG--GCIGLSPHFKC---CCK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KotsNP_650324.1 zf-MYND 9..44 CDD:460312 8/34 (24%)
TUDOR 110..225 CDD:425754
TUDOR 465..573 CDD:425754
TUDOR 743..843 CDD:425754
tag-250NP_001021188.2 TUDOR 169..284 CDD:425754
TUDOR 413..522 CDD:425754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.