DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipp and IMPL2

DIOPT Version :9

Sequence 1:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_195623.3 Gene:IMPL2 / 830067 AraportID:AT4G39120 Length:375 Species:Arabidopsis thaliana


Alignment Length:362 Identity:81/362 - (22%)
Similarity:125/362 - (34%) Gaps:105/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CAEKAANIARICRSNEQLLALLVQEKIGSEANERFEHDFKTLADVLIQETIKHEVGALFPAM-KD 80
            |...|:|..|...|||.      ..::.....:||......|||. ..|.|:......|..: ||
plant    87 CLTMASNSKRPNISNES------PSELSDTELDRFAAVGNALADA-SGEVIRKYFRKKFDIVDKD 144

  Fly    81 AILGEESPNFTNQLGESVTIAVGATEEDTAACLQAVLSGHEDAASALATEVHRDVSFSSEKLGEI 145
                :.||         ||||....||...:.:...|..|              ..:..||....
plant   145 ----DMSP---------VTIADQMAEEAMVSIIFQNLPSH--------------AIYGEEKGWRC 182

  Fly   146 AQLPDELDYGNLGIWI-DPIDATAEYISGDTMFTDFPGITSTGLDCVTVLIGVYERDTGVPVMGV 209
            .:  :..||    :|: ||||.|..:|:|..:|.             |::..:|:   |.|::|:
plant   183 KE--ESADY----VWVLDPIDGTKSFITGKPVFG-------------TLIALLYK---GKPILGL 225

  Fly   210 VAQPFGEKLEENVYSSSMFW-GVCLPTVRAHNCDFEARDENRRLGIFSSSEQSDILQRFLDLGYE 273
            :.||.   |:|.       | |:.....:.:..|...|...:            :.|.:|.....
plant   226 IDQPI---LKER-------WIGMNGRRTKLNGEDISTRSCPK------------LSQAYLYTTSP 268

  Fly   274 FAFSAGAGHKA-------LKVITHEVDVY---LLSKG-------STFK-WDTCAPQAILRALGGD 320
            ..||..| .||       :||..:..|.|   ||:.|       |..| :|..|...::...||.
plant   269 HLFSEEA-EKAYSRVRDKVKVPLYGCDCYAYALLASGFVDLVIESGLKPYDFLALVPVIEGAGGT 332

  Fly   321 VLDYAAS----VAEQKAVPLKYLIEDAEADADWKRNA 353
            :.|:...    .|...||...:.:. |..|:|..:.|
plant   333 ITDWTGKRFLWEASSSAVATSFNVV-AAGDSDIHQQA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IppNP_731872.1 IPPase 10..371 CDD:238818 81/362 (22%)
IMPL2NP_195623.3 PLN02911 80..375 CDD:178499 81/362 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.