DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipp and BPNT2

DIOPT Version :9

Sequence 1:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_060283.3 Gene:BPNT2 / 54928 HGNCID:26019 Length:359 Species:Homo sapiens


Alignment Length:336 Identity:74/336 - (22%)
Similarity:131/336 - (38%) Gaps:100/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVEEQASLLRVLINCAEKAAN-IARICRSNEQLLALLVQEKIGSEANERFEHDFKTLADVLIQET 66
            |..:...:|.|.:..|.:..: :.|:..||      ::.||...:..|..| |..|..|||....
Human    59 GTVDLREMLAVSVLAAVRGGDEVRRVRESN------VLHEKSKGKTREGAE-DKMTSGDVLSNRK 116

  Fly    67 IKHEVGALFPAMKDAILGEESPNFTNQLGESVTIAVGATEEDTAACLQAVLSGHEDAASALATEV 131
            :.:.:...||                      ::.:...|...||..:.:|..|:     :..::
Human   117 MFYLLKTAFP----------------------SVQINTEEHVDAADQEVILWDHK-----IPEDI 154

  Fly   132 HRDVSFSSEKLGEIAQLPDELDYGNLGIWIDPIDATAEYISGDTMFTDFPGITSTGLDCVTVLIG 196
            .::|:           .|.|:...::.:||||:|||.||......:.       |.:.||.|   
Human   155 LKEVT-----------TPKEVPAESVTVWIDPLDATQEYTEDLRKYV-------TTMVCVAV--- 198

  Fly   197 VYERDTGVPVMGVVAQPFGEKLE-------ENVYSSSMFWGVCLPTV---RAHNCDFEARDENRR 251
                 .|.|::||:.:||.|...       .||.:.|.: ....|.:   |:|:      ...::
Human   199 -----NGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSY-NEKTPRIVVSRSHS------GMVKQ 251

  Fly   252 LGIFSSSEQSDILQRFLDLGYEFAFSAGAGHKALKVI------THEVDVYLLSKGSTF--KWDTC 308
            :.:.:...|:.|:.           :.|||:|.|.::      ..:.|:|:   ..|:  |||.|
Human   252 VALQTFGNQTTIIP-----------AGGAGYKVLALLDVPDKSQEKADLYI---HVTYIKKWDIC 302

  Fly   309 APQAILRALGG 319
            |..|||:||||
Human   303 AGNAILKALGG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IppNP_731872.1 IPPase 10..371 CDD:238818 73/329 (22%)
BPNT2NP_060283.3 IPPase 66..349 CDD:238818 73/329 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..106 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.