DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipp and CG17028

DIOPT Version :9

Sequence 1:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster


Alignment Length:327 Identity:69/327 - (21%)
Similarity:105/327 - (32%) Gaps:110/327 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KIGSEANERFEHDFKTLADVLIQETIKHEVGALFPAMKDAILGEESPNFTNQLGESVTIAVGATE 106
            |...|....| :|..|:.|..|:.|:...:...||..|  |:|||                    
  Fly    36 KTDYEVKSAF-YDLVTVYDKQIEATLTDGLLKTFPESK--IIGEE-------------------- 77

  Fly   107 EDTAACLQAVLSGHEDAASALATEVHRDVSFSSEKLGEIAQLPDELDYGNLGIW-IDPIDATAEY 170
                               |:|.                |:.|.||.  :...| |||||.|..|
  Fly    78 -------------------AMAN----------------AKTPPELT--DAPTWIIDPIDGTNNY 105

  Fly   171 ISGDTMFTDFPGITSTGLDCVTVLIGVYERDTGVPVMGVVAQPFGEKLEENVYSSSMFWGVCL-- 233
            :      ...|..      |::|.:.:.:.    .|:|:|..|...:|    ||:....|..|  
  Fly   106 V------RKIPHC------CISVGLAINKE----LVLGIVYNPSANEL----YSAWQGHGAYLNG 150

  Fly   234 PTVRAHNCDFEARDENRRLGIFS------SSEQSDILQRFLDLGYEFAFSAGAGHKALK---VIT 289
            ..:...|    |:..|:.|..:.      |..:...::|...|......:...|..||.   :..
  Fly   151 QPIEVSN----AKKINQALVCYEISLIVVSKGRDKNVKRLYKLASSATGTRSFGCAALTLCYIAA 211

  Fly   290 HEVDVYLLSKGSTFKWDTCAPQAILRALGG----------DVL--DYAASVAEQKAVPLKYLIED 342
            ...|.|.:.  :...||......|||..||          ||:  |...:.:|:.|..:..|||.
  Fly   212 GRCDAYHVE--NLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSEELAKSVIQLIEG 274

  Fly   343 AE 344
            |:
  Fly   275 AD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IppNP_731872.1 IPPase 10..371 CDD:238818 69/327 (21%)
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 63/309 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.