DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipp and CG17026

DIOPT Version :9

Sequence 1:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster


Alignment Length:307 Identity:65/307 - (21%)
Similarity:108/307 - (35%) Gaps:112/307 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QAVLSGHEDAASALAT---EVHRDVS--------FSSEKLGEIAQLPDELDYG------------ 155
            :.:|.|:::|..|:|.   |.:..|:        |..||:  :|:.||....|            
  Fly    24 EILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKI--LARYPDHKFIGEEDTHKNDNVTK 86

  Fly   156 ---NLGIW-IDPIDATAEYISGDTMFTDFPGIT-STGLDCVTVLIGVYERDTGVPVMGVVAQPFG 215
               :...| |||||.|:.:|.      ..|.:: |.||.....:           |:|||..|..
  Fly    87 ELTDAPTWIIDPIDGTSNFIK------QIPHVSVSIGLSIKKQI-----------VLGVVNNPAQ 134

  Fly   216 EKLE--------------------ENVYSSSMFWGVCL---PTVRAHNCD--FEARDENRRLGIF 255
            .||.                    |::..:::.:.|||   |.:|..:..  :......|||..:
  Fly   135 NKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLAY 199

  Fly   256 SSSEQSDILQRFLDLGYEFAFSAGAGHKALKVITHEVDVYLLSKGSTFKWDTCAPQAILRALGG- 319
            |:...|..:   :..|...||             |..|:|        .||..|...::|..|| 
  Fly   200 SAVVDSLCM---VAAGNLDAF-------------HIEDMY--------PWDCAAGYLLIREAGGV 240

  Fly   320 ---------DVL--DYAASVAEQKAVPLKYLIEDAEADADWKRNAGG 355
                     |::  |...:..|.....:::||.    .||.:::.||
  Fly   241 VTHPYGGPFDIMKPDLICAGTETLRAEIEHLIR----KADQEKHVGG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IppNP_731872.1 IPPase 10..371 CDD:238818 65/307 (21%)
CG17026NP_648820.1 IMPase 11..259 CDD:238817 58/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.