DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipp and CG15743

DIOPT Version :9

Sequence 1:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster


Alignment Length:386 Identity:92/386 - (23%)
Similarity:151/386 - (39%) Gaps:119/386 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LRVLINCAEKAA-----NIARICRSNEQLLALLVQEKIGSEANERFEHDFKTLADVLIQETIKHE 70
            ||.::..|.:||     .:..:.||.:      ::|:...:.:|.....| |.||......:|..
  Fly    57 LRKMLIAAIQAAQRGGLEVLDVARSRQ------LKERSKGKTDEGVNDPF-TDADGRSHCVMKQG 114

  Fly    71 VGALFPAMKDAILGEESPNFTNQLGESVTIAVGATEEDTAACLQAVLSGHEDAASALATEVHRDV 135
            :..:||.::.                       .:|||...|.||  .|::              
  Fly   115 LQRIFPRVQI-----------------------FSEEDKEHCKQA--HGYD-------------- 140

  Fly   136 SFSSEKLGEIAQLPD-ELDYGNLGIWIDPIDATAEYISGDTMFTDFPGITSTGLDCVTVLIGVYE 199
             .....|.|.||:|| .::..::.:|:||:|||.|       ||:......|.:.||.|      
  Fly   141 -LDPTVLHETAQIPDVTVNAQDVTVWVDPLDATKE-------FTEELYEYVTTMVCVAV------ 191

  Fly   200 RDTGVPVMGVVAQPF---------GEKLEENVYSSSMF-------WGVCLPTVRAHNCDFEARDE 248
              .|.|::||:..||         |..:.|  |.|::.       ....:...|:|...  |:|.
  Fly   192 --AGRPIIGVIHSPFNGQTAWAWVGNSMSE--YLSNLHPQHSPNNQAPIITVSRSHTAG--AKDL 250

  Fly   249 NRRLGIFSSSEQSDILQRFLDLGYEFAFSAGAGHKALKVITHEVDVYLLSKGSTFKWDTCAPQAI 313
            .|  |||  .|...:|.           :||||:|.|:|:.:....| |......|||.||..||
  Fly   251 AR--GIF--GENVSLLT-----------AAGAGYKVLQVVANNATAY-LHTSKIKKWDICAGDAI 299

  Fly   314 LRALGGDVLDYAASVAEQKAVPLKYLIEDAEADADWKRNAGGIISVRNVDVVDELLAKLAE 374
            |.||||.:    .::.:|.   :.|..|::..      |..|:::  .::..||.:.||::
  Fly   300 LHALGGTM----TTLNDQL---INYGPEESPV------NTEGLLA--TLEQHDEYMDKLSK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IppNP_731872.1 IPPase 10..371 CDD:238818 90/381 (24%)
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 88/379 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445191
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43028
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.