DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipp and Bpnt2

DIOPT Version :9

Sequence 1:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_808398.1 Gene:Bpnt2 / 242291 MGIID:1915720 Length:356 Species:Mus musculus


Alignment Length:331 Identity:87/331 - (26%)
Similarity:134/331 - (40%) Gaps:90/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVEEQASLLRVLINCAEKAAN-IARICRSNEQLLALLVQEKIGSEANERFEHDFKTLADVLIQET 66
            |..:...:|.|.:..||:..: :.|:..||      ::.||...:..|..: |..|..|||....
Mouse    57 GTVDLREMLAVAVLAAERGGDEVRRVRESN------VLHEKSKGKTREGAD-DKMTSGDVLSNRK 114

  Fly    67 IKHEVGALFPAMKDAILGEESPNFTNQLGESVTIAVGATEEDTAACLQAVLSGHEDAASALATEV 131
            :.:.:...||                    :|.|   .|||            |.||:.......
Mouse   115 MFYLLKTAFP--------------------NVQI---NTEE------------HVDASDKEVIVW 144

  Fly   132 HRDVSFSSEKLGEIAQLPDELDYGNLGIWIDPIDATAEYISGDTMFTDFPGITSTGLDCVTVLIG 196
            :|.:  ..:.|.||| .|.|:...::.:||||:|||.||......:.       |.:.||.|   
Mouse   145 NRKI--PEDILKEIA-APKEVPAESVTVWIDPLDATQEYTEDLRKYV-------TTMVCVAV--- 196

  Fly   197 VYERDTGVPVMGVVAQPFGEKLEENVYSSSMFWGVC--LPTVRAHNCDFEARDENRRLGIFSSSE 259
                 .|.||:||:.:||.|      |::   |.:.  ...|:|.:    :.:|.....|.|.|.
Mouse   197 -----NGKPVLGVIHKPFSE------YTA---WAMVDGGSNVKARS----SYNEKTPKIIVSRSH 243

  Fly   260 QSDILQRFLD-LGYEFAF--SAGAGHKALKVI-----THE-VDVYLLSKGSTF--KWDTCAPQAI 313
            ...:.|..|. .|.:.:.  :.|||:|.|.::     |.| .|:|:   ..|:  |||.||..||
Mouse   244 AGMVKQVALQTFGNQTSIIPAGGAGYKVLALLDVPDMTQEKADLYI---HVTYIKKWDICAGNAI 305

  Fly   314 LRALGG 319
            |:||||
Mouse   306 LKALGG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IppNP_731872.1 IPPase 10..371 CDD:238818 86/324 (27%)
Bpnt2NP_808398.1 IPPase 64..347 CDD:238818 86/324 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.