DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipp and BPNT1

DIOPT Version :9

Sequence 1:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_005273055.1 Gene:BPNT1 / 10380 HGNCID:1096 Length:323 Species:Homo sapiens


Alignment Length:400 Identity:96/400 - (24%)
Similarity:150/400 - (37%) Gaps:146/400 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLRVLINC---AEKAANIARICRSNEQLLA---LLVQEKIGSEANERFEHDFKTLADVLIQETIK 68
            |:|::.:.   |:||..|.|      :::|   |.:.||..:.       |.:|.||.|.|.:|.
Human     8 LMRLVASAYSIAQKAGMIVR------RVIAEGDLGIVEKTCAT-------DLQTKADRLAQMSIC 59

  Fly    69 HEVGALFPAMKDAILGEESPNFTNQLGESVTIAVGATEEDTAACLQAVLSGHEDAASALATEVHR 133
            ..:...||  |..|:||                                   ||..|   .||.:
Human    60 SSLARKFP--KLTIIGE-----------------------------------EDLPS---EEVDQ 84

  Fly   134 DVSFSSEKLGEIAQLPDELDYG-----NLGIWIDPIDATAEYISGDTMFTDFPGITSTGLDCVTV 193
            :: ....:..||.:.|....|.     :|.:|:||:|.|.||..|             .||.|||
Human    85 EL-IEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEG-------------LLDNVTV 135

  Fly   194 LIGV-YERDTGVPVMGVVAQPF-------GEKLEE---------NVYSSSMFWGV---------- 231
            |||: ||   |..:.||:.||:       .::|.|         :.......|||          
Human   136 LIGIAYE---GKAIAGVINQPYYNYENNEKQQLREHRNEAKAGPDAVLGRTIWGVLGLGAFGFQL 197

  Fly   232 --------CLPTVRAHNCDFEARDENRRLGIFSSSEQSDILQRFLDLGYEFAFSAGAGHKALKVI 288
                    .:.|.|:|:        |:.:....::...|.:.|.          .|||:|.:::|
Human   198 KEVPAGKHIITTTRSHS--------NKLVTDCVAAMNPDAVLRV----------GGAGNKIIQLI 244

  Fly   289 THEVDVYLLSKGSTFKWDTCAPQAILRALGGDVLDYAASVAEQKAVPLKYLIEDAEADADWKRNA 353
            ..:...|:.:.....|||||||:.||.|:||.:.|...:|       |:|     ..|.....:|
Human   245 EGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNV-------LQY-----HKDVKHMNSA 297

  Fly   354 GGIISVRNVD 363
            |.:.::||.|
Human   298 GVLATLRNYD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IppNP_731872.1 IPPase 10..371 CDD:238818 95/399 (24%)
BPNT1XP_005273055.1 IPPase 11..312 CDD:238818 93/396 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.