DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt6

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_849222.3 Gene:Prmt6 / 99890 MGIID:2139971 Length:378 Species:Mus musculus


Alignment Length:347 Identity:123/347 - (35%)
Similarity:183/347 - (52%) Gaps:45/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASK 79
            :|..|::.||.:..|..|:.|.||.:|:|..|:::....:.|.|||||.||||||:|.|:|||.:
Mouse    46 RDQLYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQAGARR 110

  Fly    80 VIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINS 144
            |.|||.:.|...|.|::|.|..|:.|.|:.|.||.||||   |:||.|||||||..|..|:|::|
Mouse   111 VYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELP---ERVDAIVSEWMGYGLLHESMLSS 172

  Fly   145 VLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVE---GIDMGCVRKPFSQEPLV-- 204
            ||.||.|||..||.:||::..|::....|......|.||..|:   |:||.|: :.|:...|:  
Mouse   173 VLHARTKWLKEGGLLLPASAELFVAPISDQMLEWRLGFWSQVKQHYGVDMSCM-ESFATRCLMGH 236

  Fly   205 -EFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGI--------------------- 247
             |.| :|.|..::        .:||  |..|.   ||::.|.|:                     
Mouse   237 SEIV-VQDLSGED--------VLAR--PQRFA---QLELARAGLEQELEAGVGGRFRCSCYGSAP 287

  Fly   248 INMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQD 312
            ::...::|.|.||.|.|.|.:.|:|||..|.|||:|.:|:|:||:.|.....:.|.:.:.|:..:
Mouse   288 LHGFAVWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVPVEQDTDISGEITLLPSPDN 352

  Fly   313 GRGMNFDLHISFRGERTRVESF 334
            .|.:...|.........:.:.|
Mouse   353 PRRLRILLRYKVGDHEEKTKDF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 67/131 (51%)
Prmt6NP_849222.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 123/347 (35%)
Methyltransf_18 85..188 CDD:289607 59/105 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1503
OMA 1 1.010 - - QHG54098
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.