DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and cmoB

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_416385.1 Gene:cmoB / 946387 ECOCYCID:G7021 Length:323 Species:Escherichia coli


Alignment Length:259 Identity:58/259 - (22%)
Similarity:91/259 - (35%) Gaps:100/259 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 AEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRG 156
            :||.:...|.:.:..:::.|:...:.|..:..|: |.:||                 |..|  :.
E. coli    67 SEEPLSAGQIKRIETLMRNLMPWRKGPFSLYGVN-IDTEW-----------------RSDW--KW 111

  Fly   157 GRILPS----TG------------NLWLM---GAY-----DPHRRTNLNFWCNVEGIDMGCVRKP 197
            .|:||.    ||            ::|.|   ||:     ||   |.| |.|..|     .|||.
E. coli   112 DRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDP---TQL-FLCQFE-----AVRKL 167

  Fly   198 FSQEPLVEFVP--IQQLLTDECF--IHSTNLAVARNQPVEFQSNFQLK---------VMRTGIIN 249
            ...:.....:|  |:||...:.|  :.|..:...|..|:|..  :|||         |:.|.:|:
E. coli   168 LGNDQRAHLLPLGIEQLPALKAFDTVFSMGVLYHRRSPLEHL--WQLKDQLVNEGELVLETLVID 230

  Fly   250 ---------------MLVLYFDVLFPSGKSNKS--------------VSLTTSPHSPWTHWEQT 284
                           |..:||   .||..:.|:              ||:||:.....|.|..|
E. coli   231 GDENTVLVPGDRYAQMRNVYF---IPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 12/68 (18%)
cmoBNP_416385.1 PRK15068 1..322 CDD:237898 58/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.