DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and rlmA

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_416336.1 Gene:rlmA / 946340 ECOCYCID:EG12207 Length:269 Species:Escherichia coli


Alignment Length:87 Identity:28/87 - (32%)
Similarity:37/87 - (42%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIV-QDGGLFQDK--IVLDVGCGTGILSL 70
            ||....:..|...|...::.....| |:...|..||||| |......||  .|||:|||.|..: 
E. coli    38 LPVQHKRSRDPGDSAEMMQARRAFL-DAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYT- 100

  Fly    71 FAAEAGASKVIAVECTDIADIA 92
             .|.|.|...|.....|::.:|
E. coli   101 -HAFADALPEITTFGLDVSKVA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 24/67 (36%)
rlmANP_416336.1 rrmA 1..269 CDD:236841 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.