DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and yafE

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_414746.1 Gene:yafE / 946197 ECOCYCID:EG11651 Length:207 Species:Escherichia coli


Alignment Length:190 Identity:45/190 - (23%)
Similarity:74/190 - (38%) Gaps:32/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FAAEAGASKVIAVECT-DIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGN 134
            |.|....|.|:|.:.: .:.|:..:.....|.:|:. ..:|..|  .||......||::|.:..:
E. coli    11 FGAAQNVSAVVAYDLSAHMLDVVAQAAEARQLKNIT-TRQGYAE--SLPFADNAFDIVISRYSAH 72

  Fly   135 ALY-MEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWC-NVEGI-DMGCVRK 196
            ..: :.|.:..|           .|||...|.|.:|....|..... :.|. .||.: |...||.
E. coli    73 HWHDVGAALREV-----------NRILKPGGRLIVMDVMSPGHPVR-DIWLQTVEALRDTSHVRN 125

  Fly   197 PFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRT--GIINMLVLY 254
            ..|.|.|.        |.:|..:...|| :....|:||.|  .:..|||  .:::.:.:|
E. coli   126 YASGEWLT--------LINEANLIVDNL-ITDKLPLEFSS--WVARMRTPEALVDAIRIY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 19/91 (21%)
yafENP_414746.1 Methyltransf_11 7..96 CDD:400514 22/98 (22%)
PRK08317 20..178 CDD:181382 42/181 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.