DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and bioC

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_415298.1 Gene:bioC / 945388 ECOCYCID:EG10119 Length:251 Species:Escherichia coli


Alignment Length:311 Identity:67/311 - (21%)
Similarity:98/311 - (31%) Gaps:104/311 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKI--VLDVGCGTGILSLFAAEAGASKVIAVE 84
            ::.|...|.....|..|..|  ||::  ..|.|.|.  |||.|||.|.:|....|..|.    |.
E. coli    12 AFGRAAAHYEQHADLQRQSA--DALL--AMLPQRKYTHVLDAGCGPGWMSRHWRERHAQ----VT 68

  Fly    85 CTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDI----IVSEWMGN------ALYME 139
            ..|::  ...:::..||:.....:.|.:|  .||......|:    :..:|.||      .||..
E. coli    69 ALDLS--PPMLVQARQKDAADHYLAGDIE--SLPLATATFDLAWSNLAVQWCGNLSTALRELYRV 129

  Fly   140 AMINSVL-FARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQEPL 203
            .....|: |..   |.:|.  ||.....|......||..                          
E. coli   130 VRPKGVVAFTT---LVQGS--LPELHQAWQAVDERPHAN-------------------------- 163

  Fly   204 VEFVP---IQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSN 265
             .|:|   |:|.|..                |.:|.:.|          .:.|:||....:.:|.
E. coli   164 -RFLPPDEIEQSLNG----------------VHYQHHIQ----------PITLWFDDALSAMRSL 201

  Fly   266 KSVSLTTSPHSPWTHWEQTVLHLDEPLYVRI--RDRVRGVLAMTPTGQDGR 314
            |.:..|               ||.|....||  |.:::.:....|. |.||
E. coli   202 KGIGAT---------------HLHEGRDPRILTRSQLQRLQLAWPQ-QQGR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 37/144 (26%)
bioCNP_415298.1 PRK10258 1..251 CDD:182340 67/311 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.