DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and yafS

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_414749.2 Gene:yafS / 944903 ECOCYCID:G6100 Length:240 Species:Escherichia coli


Alignment Length:129 Identity:32/129 - (24%)
Similarity:48/129 - (37%) Gaps:44/129 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DECFI-HSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHS-P 277
            :.|.: |..|:: |:..||:.|:            :.|.|.|        ::|||.:....|: |
E. coli    58 EACAVSHQVNVS-AQGMPVQVQA------------DPLHLPF--------ADKSVDVCLLAHTLP 101

  Fly   278 WTHWEQTVLHLDEPLYVRIRDRV---RGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSFS 338
            |.        .|....:|..|||   .|.|.::       |.|   .|||.|.|..|...:..|
E. coli   102 WC--------TDPHRLLREADRVLIDDGWLVIS-------GFN---PISFMGLRKLVPVLRKTS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624
yafSNP_414749.2 Methyltransf_11 <77..125 CDD:400514 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.