DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt3

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_446009.1 Gene:Prmt3 / 89820 RGDID:620413 Length:528 Species:Rattus norvegicus


Alignment Length:310 Identity:122/310 - (39%)
Similarity:193/310 - (62%) Gaps:14/310 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77
            |.:|..||.||.....|..||:|.||.:::||.|.|:..:|:||:||||||||||||:|||:|||
  Rat   211 EDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGA 275

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142
            .|||||:.::|...|.:|||.|:.|:.:.::||.:|:|.||  :||||:|:|||||..|..|:|:
  Rat   276 KKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLP--VEKVDVIISEWMGYFLLFESML 338

  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTN-LNFWCNVEGIDMGCVRKPFSQEPLVEF 206
            :|||:|:.|:|.:||.:.|....:.|:...|..:..: :.||.:|.|.:|.|::|....|.:||.
  Rat   339 DSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEV 403

  Fly   207 VPIQQLLTDECFI-----HSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNK 266
            |..:.|::|.|.|     |:|:::     .:||.|:|.|:..:|.:...:..|||:.|.....|:
  Rat   404 VDHKTLISDPCDIKHIDCHTTSIS-----DLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNR 463

  Fly   267 SVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGM 316
             |..:|.|.|..|||:||:..|::|..|:..:.::|.:.:....:|.|.:
  Rat   464 -VVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 70/131 (53%)
Prmt3NP_446009.1 zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 57/101 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342028
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.