DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and ERG6

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_013706.1 Gene:ERG6 / 855003 SGDID:S000004467 Length:383 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:40/200 - (20%)
Similarity:63/200 - (31%) Gaps:96/200 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GLFQDKIVLDVGCGTG-------------ILSL------------FAAEAGAS------------ 78
            |:.:..:|||||||.|             ::.|            :|.:...|            
Yeast   116 GIQRGDLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVKGDFMK 180

  Fly    79 ---------KVIAVECTDIAD--------------------IAEEIIRDNQKENVVKVVKGLVEQ 114
                     ||.|:|.|..|.                    :.|.::.|...||..:..| :..:
Yeast   181 MDFEENTFDKVYAIEATCHAPKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRK-IAYE 244

  Fly   115 VELPDGIEKV---------------DIIVSE----------W----MGNALYMEAMINSVLFARD 150
            :||.|||.|:               :::|||          |    .|...|::.:.|...|.|.
Yeast   245 IELGDGIPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNLANLATFFRT 309

  Fly   151 KWLTR 155
            .:|.|
Yeast   310 SYLGR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 39/199 (20%)
ERG6NP_013706.1 Cfa 66..>277 CDD:225139 32/161 (20%)
Methyltransf_11 124..222 CDD:400514 16/97 (16%)
Sterol_MT_C 306..368 CDD:400686 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.