Sequence 1: | NP_650322.1 | Gene: | Art6 / 41699 | FlyBaseID: | FBgn0038189 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_177736.1 | Gene: | SMT3 / 843941 | AraportID: | AT1G76090 | Length: | 359 | Species: | Arabidopsis thaliana |
Alignment Length: | 268 | Identity: | 47/268 - (17%) |
---|---|---|---|
Similarity: | 81/268 - (30%) | Gaps: | 133/268 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SFNANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCG-- 64
Fly 65 --------------TGI---------LSLFAAEAGASKVIAVECTD------------------- 87
Fly 88 ------IADIAEEIIR----------------------DNQKENVVKVVK------GLVEQVELP 118
Fly 119 DGIEKVDI-IVSE-----------W----MGNALY---------MEAM---------INSVLFAR 149
Fly 150 DKWLTRGG 157 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art6 | NP_650322.1 | AdoMet_MTases | 29..>161 | CDD:302624 | 41/241 (17%) |
SMT3 | NP_177736.1 | PLN02244 | 77..355 | CDD:215135 | 47/268 (18%) |
Sterol_MT_C | 292..354 | CDD:400686 | 11/47 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |