DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and SMT3

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_177736.1 Gene:SMT3 / 843941 AraportID:AT1G76090 Length:359 Species:Arabidopsis thaliana


Alignment Length:268 Identity:47/268 - (17%)
Similarity:81/268 - (30%) Gaps:133/268 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFNANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCG-- 64
            ||:.:..:|....||:      :|:  |..|..|.::        |:.|     :.:||.|||  
plant    92 SFHFSPHVPGKSDKDA------TRI--HEEMAVDLIK--------VKPG-----QKILDAGCGVG 135

  Fly    65 --------------TGI---------LSLFAAEAGASKVIAVECTD------------------- 87
                          |||         ..|...:||...:..|.|.:                   
plant   136 GPMRAIAAHSKAQVTGITINEYQVQRAKLHNKKAGLDSLCNVVCGNFLKMPFDENTFDGAYSIEA 200

  Fly    88 ------IADIAEEIIR----------------------DNQKENVVKVVK------GLVEQVELP 118
                  :.::..||.|                      |.:.::|::.::      ||....::.
plant   201 TCHAPKLEEVYSEIFRVMKPGSLFVSYEWVTTEKYRDDDEEHKDVIQGIERGDALPGLRSYADIA 265

  Fly   119 DGIEKVDI-IVSE-----------W----MGNALY---------MEAM---------INSVLFAR 149
            ...:||.. :|.|           |    ||...|         :.|:         ::.:||..
plant   266 VTAKKVGFEVVKEKDLAKPPSKPWWNRLKMGRIAYWRNHVVVVILSAIGVAPKGTVDVHKMLFKT 330

  Fly   150 DKWLTRGG 157
            ..:|||||
plant   331 ADYLTRGG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 41/241 (17%)
SMT3NP_177736.1 PLN02244 77..355 CDD:215135 47/268 (18%)
Sterol_MT_C 292..354 CDD:400686 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.