DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and AT1G73600

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_974139.2 Gene:AT1G73600 / 843694 AraportID:AT1G73600 Length:504 Species:Arabidopsis thaliana


Alignment Length:187 Identity:43/187 - (22%)
Similarity:66/187 - (35%) Gaps:52/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRM--QAFRDAIVQDGGL-----FQDKI---- 57
            |.||.....:...||..:.:.|...::......:..  :.|.:..|..|||     |.|.:    
plant   231 NQNQICWLWQKVSSDNDRGFQRFLDNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKP 295

  Fly    58 ---VLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPD 119
               |||||||.|....:.||.....|:.:      |::..:|....:..:     ||...||   
plant   296 GQKVLDVGCGIGGGDFYMAENFDVDVVGI------DLSVNMISFALEHAI-----GLKCSVE--- 346

  Fly   120 GIEKVDIIVSEWMGNALYMEAMINSVLFARD----------------KWLTRGGRIL 160
             .|..|....|:..|..       .|:::||                |||..||::|
plant   347 -FEVADCTKKEYPDNTF-------DVIYSRDTILHIQDKPALFRRFYKWLKPGGKVL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 37/162 (23%)
AT1G73600NP_974139.2 Methyltransf_11 71..169 CDD:285453
Methyltransf_11 300..396 CDD:285453 29/118 (25%)
PLN02336 30..504 CDD:177970 43/187 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.