DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and AT1G69526

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001031256.1 Gene:AT1G69526 / 843287 AraportID:AT1G69526 Length:307 Species:Arabidopsis thaliana


Alignment Length:181 Identity:39/181 - (21%)
Similarity:75/181 - (41%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VLDVGCGTG-ILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVK-----VVKGLVEQVE 116
            ||::|.||| .|..||    .::.:.|...|.....|:...::.:|..:|     .:.|:.|.:.
plant   134 VLEIGVGTGPNLKYFA----GNENVCVFGMDPNHKMEKYACESAREAGMKPENFRFMHGVGEAIP 194

  Fly   117 LPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWL----MGAYDPHRR 177
            |.|  :.:|.:|      |..:...::.|    .:.|....|:| ..|.::|    :.|.|.   
plant   195 LDD--DSMDSVV------ATLVLCSVSDV----TQTLNEIKRVL-KPGGIFLFIEHVAAKDG--- 243

  Fly   178 TNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFI-HSTNLAVA 227
               :|:.:|:.:                ..||||::.|.|.: .:|:|.::
plant   244 ---SFFRHVQNV----------------LDPIQQVVADGCHLTRNTDLHIS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 24/108 (22%)
AT1G69526NP_001031256.1 Methyltransf_11 135..234 CDD:400514 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.