DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT10

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_563720.1 Gene:PRMT10 / 839393 AraportID:AT1G04870 Length:383 Species:Arabidopsis thaliana


Alignment Length:354 Identity:119/354 - (33%)
Similarity:186/354 - (52%) Gaps:44/354 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVI 81
            :.||.:||.|....:||.|.|||.|:.:|:.|:...|:.|.|||||.|:|||::::|:|||.||.
plant    33 AQYFCTYSFLYHQKDMLSDRVRMDAYFNAVFQNKHHFEGKTVLDVGTGSGILAIWSAQAGARKVY 97

  Fly    82 AVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVL 146
            |||.|.:||.|..:::.|..:::|:|::|.||.:.||   ||||:|:|||||..|..|:|.:||:
plant    98 AVEATKMADHARALVKANNLDHIVEVIEGSVEDISLP---EKVDVIISEWMGYFLLRESMFDSVI 159

  Fly   147 FARDKWLTRGGRILPSTGNLWL--MGAYDPHRRTN-----LNFWCNVE-------GIDMGCVRKP 197
            .|||:||...|.:.||...:||  :.:....|:.|     :..|.|..       |:|||.:.||
plant   160 SARDRWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMADWHNFSDEIKSYYGVDMGVLTKP 224

  Fly   198 FSQEPLVEFVPI--------QQLLTDECFIHSTN-LAVARNQPVEFQSNFQLKVMRTGIINM--- 250
            |::|....::..        ||::.....:...: |..:.::..|.:||.      |.:|||   
plant   225 FAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTASVSEIEEVRSNV------TSVINMEHT 283

  Fly   251 ----LVLYFDVLFPSGK---SNKSVSLTTSP-HSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMT 307
                ...:|||.|...|   :.:.:.|||:| ....|||.|.|..:..|:.|...|.:...|.|:
plant   284 RLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHWGQQVFIMSNPINVEEGDNLNLGLLMS 348

  Fly   308 PTGQDGRGMNFDLHISFR-GERTRVESFK 335
            .:.::.|.|..:|:...: ......||||
plant   349 RSKENHRLMEIELNCEIKEASGNPKESFK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 62/131 (47%)
PRMT10NP_563720.1 Methyltransf_25 74..170 CDD:379312 50/98 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.