DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and AT1G22800

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_173694.1 Gene:AT1G22800 / 838886 AraportID:AT1G22800 Length:355 Species:Arabidopsis thaliana


Alignment Length:279 Identity:49/279 - (17%)
Similarity:93/279 - (33%) Gaps:93/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIV--QDGGLFQDKI---VLD------------- 60
            |.|.::.|:.|:::.   ..||..|:...|.|.:  |....|.|.:   :||             
plant    41 GGDGEFQQNSSKVKI---FDRDLKRIHRDRAAWLSRQKNDSFVDAVADNLLDRLEDCKKSFPTAF 102

  Fly    61 -VGCGTG-ILSLFAAEAGASKVIAVE--------CTDIADIAEEIIRDNQKENVVKVVKGLVEQV 115
             :|...| :..|.....|..|:|.::        |.|        .:|:..:|.::....:.::.
plant   103 CLGGSLGAVKRLLRGRGGIEKLIMMDTSYDMIKSCRD--------AQDDSLDNSIETSYFVGDEE 159

  Fly   116 ELPDGIEKVDIIVS----EWMG---------------NALYMEAMINSVLFARDK------WLTR 155
            .||.....||:|:|    .|..               :.|::.|::........:      .:.|
plant   160 FLPVKESSVDLIISSLGLHWTNDLPGSMIQCKLALKPDGLFLAAILGGETLKELRIACTLAHMER 224

  Fly   156 GGRILP---------STGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQ 211
            .|.|.|         ..|||.....:            ::.|:|:        .|.:|::.....
plant   225 EGGISPRLSPLAQVRDAGNLLTRAGF------------SLPGVDV--------DEYVVKYKRAMD 269

  Fly   212 LLTDECFIHSTNLAVARNQ 230
            |:.....:..||..:.||:
plant   270 LIEHLRAMGETNALLERNK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 32/184 (17%)
AT1G22800NP_173694.1 BioC 83..326 CDD:273953 37/234 (16%)
AdoMet_MTases 104..201 CDD:302624 18/104 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.