DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and AT1G16445

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_683312.2 Gene:AT1G16445 / 838215 AraportID:AT1G16445 Length:274 Species:Arabidopsis thaliana


Alignment Length:162 Identity:27/162 - (16%)
Similarity:54/162 - (33%) Gaps:75/162 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DAIVQDGGLFQD-------------KIVL--DVGCGTGILSL------------FAAEAGASKVI 81
            :.::|.|....|             |:|:  .||||..:.::            ...:|..||  
plant    92 EQVIQKGDTVIDATCGNGNDTLAMLKMVMHDSVGCGGYVYAMDIQKDAIESTSSLLDQAVGSK-- 154

  Fly    82 AVECTDIADIAE----EIIRDNQKENVV-----------------------------KVVK---- 109
            ..||..:.::..    ||:.:|.:..:|                             :::|    
plant   155 EKECVKLFNLCHSKMGEIVPENARVRMVAFNLGYLPGGNKSIITLSDTTLSALKAAERILKPGGL 219

  Fly   110 -GLVEQVELPDGIEKVDII--------VSEWM 132
             .||..:..|.|.|:::::        ||:|:
plant   220 ISLVVYIGHPGGREELEVVEAFGSGLPVSDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 27/162 (17%)
AT1G16445NP_683312.2 AdoMet_MTases 95..>143 CDD:302624 9/47 (19%)
rRNA_methylase 132..269 CDD:284399 18/122 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.