DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT4A

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_199713.2 Gene:PRMT4A / 834961 AraportID:AT5G49020 Length:528 Species:Arabidopsis thaliana


Alignment Length:328 Identity:99/328 - (30%)
Similarity:161/328 - (49%) Gaps:34/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||..|.:|....|||:|.||...:..|::::...|..::|:|||.|:||||:|||.|||..|.||
plant   151 YFHYYGQLLHQQNMLQDYVRTGTYHAAVMENRSDFSGRVVVDVGAGSGILSMFAALAGAKHVYAV 215

  Fly    84 ECTDIADIAEEIIRDNQ--KENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVL 146
            |.:::|:.|.::|..|.  .|.:. |:||.:|.:|||   ||.|:::||.||..|..|.|:.:.:
plant   216 EASEMAEYARKLIAGNPLLAERIT-VIKGKIEDIELP---EKADVLISEPMGTLLVNERMLETYV 276

  Fly   147 FARDKWLTRGGRILPSTGNLWLMGAYDP----HRRTNLNFW--CNVEGIDMG----CVRKPFSQE 201
            .|||::|:..|::.|:.|.:.:....|.    .......||  .|..|:|:.    ...:.:..:
plant   277 IARDRFLSPNGKMFPTVGRIHMAPFADEFLFVEMANKALFWQQQNYYGVDLTPLYVSAHQGYFSQ 341

  Fly   202 PLVE-FVPIQQLLTDECFIHSTNLAVARNQ-------PVEFQSNFQLKVMRTGIINMLVLYFDVL 258
            |:|: |.|  :||......|..:..:...:       |::|.::...:      |:.|..:||||
plant   342 PVVDAFDP--RLLVAPSMFHVIDFTMMTEEQFYEIDIPLKFTASVCTR------IHGLACWFDVL 398

  Fly   259 FPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHIS 323
            |..  |......||:|.:|.|||.|....|.:|::|.....:.|.|.:.........:|..|...
plant   399 FDG--STVQRWFTTAPGAPTTHWYQIRCVLSQPIHVMAGQEITGRLHLIAHSAQSYTINLTLSAK 461

  Fly   324 FRG 326
            ..|
plant   462 MWG 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 54/133 (41%)
PRMT4ANP_199713.2 SmtA 140..400 CDD:223574 81/260 (31%)
AdoMet_MTases 160..>300 CDD:302624 56/143 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.