DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and AT3G61210

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_191680.1 Gene:AT3G61210 / 825293 AraportID:AT3G61210 Length:261 Species:Arabidopsis thaliana


Alignment Length:232 Identity:45/232 - (19%)
Similarity:76/232 - (32%) Gaps:82/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLPFLEGKDSD-YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLF 71
            :|..|.||.:| |..:..:..|....              |..|.....|:..|||.|.|..::.
plant     3 QLAALSGKQADEYLNARPKYPTIWYK--------------VLAGRTSNHKVAWDVGTGNGQAAIG 53

  Fly    72 AAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLV----------EQVELPDGIEKVDI 126
            .||. ..||:|.:           |.::|.:..:|..|...          :.|.|..|...:||
plant    54 VAEY-YQKVVATD-----------INESQLQRAMKHPKVTYYHTPSSMSDDDLVTLLGGENSIDI 106

  Fly   127 IVSE----------------------------WMGNALYMEAMINSVLFARDKWLTRGGRILPST 163
            |::.                            |:.|.|.:...::|::          .|::.||
plant   107 IIAAQALHYFDLKRFYPIVKRVLRKQGGIIVVWVYNDLIITPKVDSIM----------KRLVDST 161

  Fly   164 ---GNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKP 197
               .|..:..|:|.::.....|    :.|.||...:|
plant   162 LPYRNPTMNLAFDGYKTIEFPF----KNIRMGTQGRP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 28/169 (17%)
AT3G61210NP_191680.1 Methyltransf_25 42..133 CDD:404528 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.