DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT6

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001326463.1 Gene:PRMT6 / 821541 AraportID:AT3G20020 Length:443 Species:Arabidopsis thaliana


Alignment Length:360 Identity:122/360 - (33%)
Similarity:193/360 - (53%) Gaps:43/360 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKV 80
            |..||.||:.:..|..|::|..|.:.:|:||:|...|.:.|:|:||||||||||:|.|:|||.:|
plant    80 DVAYFHSYAHVGIHEEMIKDRARTETYREAIMQHQSLIEGKVVVDVGCGTGILSIFCAQAGAKRV 144

  Fly    81 IAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSV 145
            .||:.:|||..|:|:::.|...:.|.|:.|.||.||:.   |:||:|:|||||..|..|:|:.||
plant   145 YAVDASDIAVQAKEVVKANGLSDKVIVLHGRVEDVEID---EEVDVIISEWMGYMLLYESMLGSV 206

  Fly   146 LFARDKWLTRGGRILPSTGNLWLMGAYDPHRRT-NLNFWCNVEGIDMGCVRKPFSQ----EPLVE 205
            :.|||:||..||.||||...|::.....|.|.: :::||.||.||||..:.:...|    ||.||
plant   207 ITARDRWLKPGGLILPSHATLYMAPISHPDRYSHSIDFWRNVYGIDMSAMMQLAKQCAFEEPSVE 271

  Fly   206 FVPIQQLLT-DECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLF---------- 259
            .:..:.:|| .|...|.....:...:.....:.::...|....::....:|||.|          
plant   272 SISGENVLTWPEVVKHIDCKTIKIQELDSVTARYKFNSMMRAPMHGFAFWFDVEFSGPASSPAKN 336

  Fly   260 --------------PSGKSNK--------SVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRG 302
                          |||:.|:        ::.|:|||.||.|||:||:::..:|:.|.....:.|
plant   337 TSETSIASGSSSISPSGEVNQKKRTNPSDALVLSTSPESPPTHWQQTIVYFYDPIDVEQDQVIEG 401

  Fly   303 VLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSF 337
            .:.::.:.::.|.||  :|:.:....|....|:.|
plant   402 SVTLSQSKENKRFMN--IHLEYSLVATLFHPFQFF 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 64/131 (49%)
PRMT6NP_001326463.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.