DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and XPL1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_188427.2 Gene:XPL1 / 821324 AraportID:AT3G18000 Length:491 Species:Arabidopsis thaliana


Alignment Length:405 Identity:83/405 - (20%)
Similarity:132/405 - (32%) Gaps:183/405 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FQDKIVLDVGCGTGILSLFAAEAG--ASKVIAVECTDIADIAEEIIRDNQKEN-VVKVVKGLVEQ 114
            ::.|.||::|.|.|   .|..|..  |.::||:      |..:.:|:.|:..| ..|.||.:...
plant    52 YEGKSVLELGAGIG---RFTGELAQKAGELIAL------DFIDNVIKKNESINGHYKNVKFMCAD 107

  Fly   115 VELP-----DGIEKVDIIVSEWMGNALYMEAMINSVLFARDK-----------WLTRGGRIL--- 160
            |..|     ||  .:|:|.|.|:            :::..||           |:..||.|.   
plant   108 VTSPDLKITDG--SLDLIFSNWL------------LMYLSDKEVELLAERMVGWIKVGGYIFFRE 158

  Fly   161 ----------------------------------PSTGNLW--------LMGAYDPHRRTNLNFW 183
                                              .:.||.:        .:|||..::: |.|..
plant   159 SCFHQSGDSKRKSNPTHYREPRFYSKVFQECQTRDAAGNSFELSMIGCKCIGAYVKNKK-NQNQI 222

  Fly   184 C-------------------NVEGIDMGCVR--KPFSQ--------EPLVEFV------PIQQLL 213
            |                   ||:....|.:|  :.|.|        |...|||      |.|::|
plant   223 CWIWQKVSSENDRGFQRFLDNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVL 287

  Fly   214 TDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGI---INMLVLYFDVLFPSGKSNKSVSLT---- 271
            ...|.|...:..:|        ..|.:.|:  ||   :||:         |....:::.|:    
plant   288 DVGCGIGGGDFYMA--------EKFDVHVV--GIDLSVNMI---------SFALERAIGLSCSVE 333

  Fly   272 ------TSPHSPWTHWE-----QTVLHL-DEPLYVR-------------IRDRVRGVLAMTPTGQ 311
                  |:.|.|...::     .|:||: |:|...|             |.|..|.  ..||:.:
plant   334 FEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCRS--PKTPSAE 396

  Fly   312 -----DGRGMNFDLH 321
                 ..||  :|||
plant   397 FSEYIKQRG--YDLH 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 32/163 (20%)
XPL1NP_188427.2 PLN02336 17..491 CDD:177970 83/405 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.