DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and AT3G01660

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_186815.1 Gene:AT3G01660 / 821098 AraportID:AT3G01660 Length:273 Species:Arabidopsis thaliana


Alignment Length:195 Identity:36/195 - (18%)
Similarity:57/195 - (29%) Gaps:89/195 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIA 82
            |||           .::|....|.|.         |:||....|.|..|:..|...|    ||.|
plant   135 DYF-----------FVKDLNEDQKFE---------FEDKYFDAVLCSVGVQYLQQPE----KVFA 175

  Fly    83 VECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLF 147
                                .|.:|:|        |.|:    :|||  ..|.::.|..|     
plant   176 --------------------EVYRVLK--------PGGV----LIVS--FSNRMFYEKAI----- 201

  Fly   148 ARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQL 212
                             .:|..|......:..:.::.::||         |:|..::...|..|:
plant   202 -----------------RVWRDGTEYSRIQLVVQYFQSIEG---------FTQPEIIRQQPGAQI 240

  Fly   213  212
            plant   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 25/131 (19%)
AT3G01660NP_186815.1 PRK08317 92..>190 CDD:181382 23/110 (21%)
Methyltransf_11 <150..189 CDD:400514 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.