DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT3

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_187835.2 Gene:PRMT3 / 820407 AraportID:AT3G12270 Length:601 Species:Arabidopsis thaliana


Alignment Length:298 Identity:118/298 - (39%)
Similarity:182/298 - (61%) Gaps:22/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKV 80
            :.:||.|||....|..||.|.||.:|:|||::::..|....:|:||||||||||||||:||||:|
plant   242 NENYFGSYSSFGIHREMLSDKVRTEAYRDALLKNPTLLNGSVVMDVGCGTGILSLFAAKAGASRV 306

  Fly    81 IAVECTD-IADIAEEIIRDNQKEN------VVKVVKGLVEQVELPDGIE--KVDIIVSEWMGNAL 136
            :|||.:: :|.:|.:|.:||:..|      |::|...:||:::....|:  .||::||||||..|
plant   307 VAVEASEKMAKVATKIAKDNKVFNDNEHNGVLEVAHSMVEELDKSIQIQPHSVDVLVSEWMGYCL 371

  Fly   137 YMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQE 201
            ..|:|::|||:|||:||..||.|||.|..:::.|.  ....|:|.||.:|.|.||..:.|....:
plant   372 LYESMLSSVLYARDRWLKPGGAILPDTATMFVAGF--GKGATSLPFWEDVYGFDMSSIGKEIHDD 434

  Fly   202 ----PLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLK----VMRTGIINMLVLYFDVL 258
                |:|:.:..:.|:|....:.:.:||..:...|:|.:...|:    ..:|.:.:.:||:||..
plant   435 TTRLPIVDVIAERDLVTQPTLLQTFDLATMKPDEVDFTATATLEPTESEAKTRLCHGVVLWFDTG 499

  Fly   259 FPSG--KSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYV 294
            |.|.  |.|.:| |:|||::|.|||.||:|...||:.|
plant   500 FTSRFCKENPTV-LSTSPYTPPTHWAQTILTFQEPISV 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 67/140 (48%)
PRMT3NP_187835.2 zf-C2H2_2 57..>112 CDD:403839
AdoMet_MTases 232..>330 CDD:418430 44/87 (51%)
Methyltransf_25 284..392 CDD:404528 53/107 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.