DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT1A

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_179557.1 Gene:PRMT1A / 816486 AraportID:AT2G19670 Length:366 Species:Arabidopsis thaliana


Alignment Length:314 Identity:124/314 - (39%)
Similarity:193/314 - (61%) Gaps:5/314 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||.|||....|..||:|.||.::::|.|.::..|.:||||||||.||||||||.|:|||:.|.||
plant    48 YFDSYSHFGIHEEMLKDVVRTKSYQDVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAV 112

  Fly    84 ECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFA 148
            ||:.:||.|:||::.|...:|:.|:||.:|::|||  :.|||:|:|||||..|..|.|:::||:|
plant   113 ECSQMADTAKEIVKSNGFSDVITVLKGKIEEIELP--VPKVDVIISEWMGYFLLYENMLDTVLYA 175

  Fly   149 RDKWLTRGGRILPSTGNLWLMGAYDPHRRTN-LNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQL 212
            |:|||..||.:||...:|::....|.|.:.: :.||.:|.|.||.|:::....||||:.|...|:
plant   176 RNKWLVDGGIVLPDKASLYVTAIEDAHYKDDKVEFWDDVYGFDMSCIKRRAITEPLVDTVDGNQI 240

  Fly   213 LTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSP 277
            :||...:.:.:::........|.:.|:|...|...|:.||.||||.|.  ..:|.:..:|.|.|.
plant   241 VTDSKLLKTMDISKMAAGDASFTAPFKLVAQRNDHIHALVAYFDVSFT--MCHKKMGFSTGPKSR 303

  Fly   278 WTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTRV 331
            .|||:||||:|::.|.:...:.:.|.:.:....::.|.::..|..|..|:...:
plant   304 ATHWKQTVLYLEDVLTICEGETITGSMTIAQNKKNPRDVDIKLSYSLNGQHCNI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 69/131 (53%)
PRMT1ANP_179557.1 AdoMet_MTases 87..187 CDD:100107 57/101 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.