DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Mettl27

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006504585.1 Gene:Mettl27 / 79565 MGIID:1933146 Length:266 Species:Mus musculus


Alignment Length:131 Identity:32/131 - (24%)
Similarity:52/131 - (39%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFA 72
            ||.|.:....:|.|..:.|:.....|......:|||       |...|.::|||.||||::::..
Mouse    28 KLRFYDDWAPEYDQDVAALKYRAPRLAVDCLSRAFR-------GSPHDALILDVACGTGLVAVEL 85

  Fly    73 AEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVEL----------PDGIEKVDII 127
            ...|..:|..|      |.:.|:::..:       .:||...:.|          |:|.....||
Mouse    86 QARGFLQVQGV------DGSPEMLKQAR-------ARGLYHHLSLCTLGQEPLPDPEGTFDAVII 137

  Fly   128 V 128
            |
Mouse   138 V 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 26/110 (24%)
Mettl27XP_006504585.1 AdoMet_MTases 31..>103 CDD:388410 22/84 (26%)
Methyltransf_25 71..161 CDD:379312 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.