DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and ndufaf5

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001076363.1 Gene:ndufaf5 / 794020 ZFINID:ZDB-GENE-070410-110 Length:321 Species:Danio rerio


Alignment Length:162 Identity:33/162 - (20%)
Similarity:59/162 - (36%) Gaps:57/162 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFNANQKLPF----LEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKI----- 57
            ||::.|.:..    ::.:..|:..|          |.||.:....|:.:   |....|::     
Zfish    17 SFSSRQGMNVFDRSMKRRQKDWASS----------LLDSSKYDYLREEV---GSRVADRVYDVAR 68

  Fly    58 ----VLDVGCGTGILS----------LFAAEAGASKVIAVECTDIADIAEEIIRDNQ----KENV 104
                .||||||...::          ||..:..:|.:...:.:||.  |:.::.|.:    |||.
Zfish    69 TFPLALDVGCGRSHIAEHLSKEVVERLFLTDISSSSLRNRKTSDIP--AQCVMADEEFLPFKENT 131

  Fly   105 VKVVKG---------------LVEQVELPDGI 121
            ..:|..               .:.||..|||:
Zfish   132 FDLVLSSLSMHWINDLPGALRQIHQVLKPDGV 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 28/131 (21%)
ndufaf5NP_001076363.1 BioC 67..290 CDD:273953 22/99 (22%)
Methyltransf_11 74..165 CDD:285453 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.