DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt2

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_012826019.1 Gene:prmt2 / 780163 XenbaseID:XB-GENE-980934 Length:634 Species:Xenopus tropicalis


Alignment Length:324 Identity:108/324 - (33%)
Similarity:169/324 - (52%) Gaps:13/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAE-AGAS 78
            :|.:|:.||..|:.|:.||.|..|..|:::.|:::......|.:||:||||||:|.|.|: |...
 Frog   302 QDEEYYGSYKTLKLHLEMLSDVPRTTAYKEVILRNSSSLCGKHILDLGCGTGIISFFCAKLAQPE 366

  Fly    79 KVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMIN 143
            .|.|||.::||:....:::.|...|:|.|::...|:::||   .||||:||||||..|..|.|:.
 Frog   367 AVYAVEASEIAEQTRRLVKQNGISNLVHVIRQRAEELQLP---TKVDILVSEWMGTCLLFEFMLE 428

  Fly   144 SVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTN-LNFWCNVEGIDMGCVR----KPFSQEPL 203
            |||.|||:||...|.:.|||..:.|:.........| :.||.|...:|...::    |.|...|.
 Frog   429 SVLQARDRWLKEDGVMWPSTACIHLVPCSASKEYANKVLFWDNPYQLDFSLLKPLAAKEFFARPK 493

  Fly   204 VEFV--PIQQLLTDECFIHSTNLAVARNQPVE-FQSNFQLKVMRTGIINMLVLYFDVLFPSGKSN 265
            .::|  | :..|::.|.:...||...:...:| ..|:|...|...|:::....:|.|.|.:.:..
 Frog   494 PDYVLQP-EDCLSEPCILLHLNLKTLQLAELERMNSDFTFFVHTDGLLHGFTAWFSVQFQNLEEQ 557

  Fly   266 KSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERT 329
            ..:.|.|.|.||.|||:.|:..|||||.|:..|::.|.:.........|.|:..|.....|:.|
 Frog   558 GQLELNTGPFSPLTHWKHTLFMLDEPLQVQKGDKISGSVVFQRNSVWRRHMSVTLSWVINGKLT 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 55/132 (42%)
prmt2XP_012826019.1 2A1904 <22..>232 CDD:273344
SH3 235..287 CDD:388381
Methyltransf_25 345..442 CDD:379312 46/99 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.