DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt8

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001258314.1 Gene:Prmt8 / 688502 RGDID:1587677 Length:394 Species:Rattus norvegicus


Alignment Length:310 Identity:128/310 - (41%)
Similarity:206/310 - (66%) Gaps:5/310 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||.||:....|..||:|.||...:|:::..:..:|:||:|||||.||||||:|||:|||.||..:
  Rat    76 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI 140

  Fly    84 ECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFA 148
            ||:.|:|.:|:||:.|..:||:.:.||.||:||||  :||||||:|||||..|:.|:|:|:|:||
  Rat   141 ECSSISDYSEKIIKANHLDNVITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFA 203

  Fly   149 RDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQL 212
            |||||..||.:.|....|:::...| .::...:::|.||.|.||.|:|....:||||:.|..:|:
  Rat   204 RDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQV 268

  Fly   213 LTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSP 277
            :|:.|.|...::...:.:.:.|.|.|.|::.|...::.||.||::.|.  |.:|.:..:|:|.:|
  Rat   269 VTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFT--KCHKKMGFSTAPDAP 331

  Fly   278 WTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGE 327
            :|||:|||.:|::.|.||..:.:.|.::|.|..::.|.::|.:.:.|:|:
  Rat   332 YTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 72/131 (55%)
Prmt8NP_001258314.1 AdoMet_MTases 115..215 CDD:100107 62/101 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.