DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Carm1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_067506.2 Gene:Carm1 / 59035 MGIID:1913208 Length:608 Species:Mus musculus


Alignment Length:332 Identity:110/332 - (33%)
Similarity:180/332 - (54%) Gaps:22/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77
            |.....|||.|..|....||::|.||...::.||:|:...|:||||||||||:||||.|||:|||
Mouse   144 ESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGA 208

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142
            .|:.|||.:.:|..||.:::.|...:.:.|:.|.||:|.||   |:||||:||.||..|:.|.|:
Mouse   209 RKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERML 270

  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYDP----HRRTNLNFWC--NVEGIDMGCVR----KP 197
            .|.|.|: |:|...|.:.|:.|::.|....|.    .:.|..|||.  :..|:|:..:|    ..
Mouse   271 ESYLHAK-KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDE 334

  Fly   198 FSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRTGIINMLVLYFDVLFPS 261
            :.::|:|:...| ::|..:...::.|...|:...: ..:..|:..::.:|:::.|..:|||.|..
Mouse   335 YFRQPVVDTFDI-RILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIG 398

  Fly   262 GKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRG 326
              |..:|.|:|:|..|.|||.|.......||:.:..|.:.|...:..    .:..::|:.|..:.
Mouse   399 --SIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIA----NKRQSYDISIVAQV 457

  Fly   327 ERTRVES 333
            ::|..:|
Mouse   458 DQTGSKS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 62/131 (47%)
Carm1NP_067506.2 CARM1 35..139 CDD:402914
AdoMet_MTases 189..284 CDD:100107 49/98 (50%)
Transactivation domain 500..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.