DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and mettl7a.1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001073508.1 Gene:mettl7a.1 / 569131 ZFINID:ZDB-GENE-061027-239 Length:242 Species:Danio rerio


Alignment Length:221 Identity:46/221 - (20%)
Similarity:73/221 - (33%) Gaps:52/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFNANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGT 65
            :||:.|.|   :..|..:.|::..|.......||                       :|:||||:
Zfish    42 ISFSYNDK---MNDKKRELFRNLDRFYPSKGSLR-----------------------ILEVGCGS 80

  Fly    66 GILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKG-LVEQVELPDGIE--KVDII 127
            |  :.|......||   :.|||.....::.:..:.::|...|... :|...|....:|  .||.:
Zfish    81 G--ANFEHYPTGSK---ITCTDPNPHFKKYLEKSMEKNEHLVYDSFIVASGENLQAVEDSSVDAV 140

  Fly   128 VSEWMGNALYMEAMINSVLFARDKWLTRGGRIL--------PSTGNLWLMGAYDPH-------RR 177
            |...:   |......|.||....:.|..||...        |||...:......|.       ..
Zfish   141 VCTLV---LCSVKDTNKVLQEAKRVLRPGGAFFFLEHVVSDPSTWVYFFQHVLQPFWYFFGDGCE 202

  Fly   178 TNLNFWCNVEGIDMGCVRKPFSQEPL 203
            |....|.:::......|:....|.||
Zfish   203 TTRTTWKDIDAAGFSDVKLRHIQAPL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 29/142 (20%)
mettl7a.1NP_001073508.1 Methyltransf_11 74..171 CDD:369777 27/104 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.