DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt2

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001073644.2 Gene:prmt2 / 558841 ZFINID:ZDB-GENE-041104-1 Length:407 Species:Danio rerio


Alignment Length:307 Identity:104/307 - (33%)
Similarity:162/307 - (52%) Gaps:25/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAA-EAGAS 78
            :|.:||.:|..|..|:.||.|..|.:.:|..|:.:....::|:|||:|||||::|||.| .|..:
Zfish    76 QDDEYFGNYGTLRLHLEMLSDKPRTETYRQVILSNSAALREKVVLDLGCGTGVISLFCALLAKPA 140

  Fly    79 KVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMIN 143
            .|.|||.:.:|:..||:::.|..:.||.|.:...|.:.||   .|||::|||||||.|..|.|:.
Zfish   141 GVYAVEASSMAEHTEELVKQNGCDGVVTVFQERAENLTLP---TKVDVLVSEWMGNCLLFEYMLE 202

  Fly   144 SVLFARDKWLTRGGRILPSTGNLWLM--GAYDPHRRTNLNFWCNVEGID----MGCVRKPFSQEP 202
            |||.|||:||.:||.:.||:..|.::  .|:..:|: .:.||.|..|::    ....:|.|..:|
Zfish   203 SVLLARDRWLKKGGMMWPSSACLTIVPCQAFSDYRQ-KVEFWENPYGLNFSYLQSLAQKEFLSKP 266

  Fly   203 LVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQ--------SNFQLKVMRTGIINMLVLYFDVLF 259
            ...    ..|..::|.  ||...|.....|..|        ..|...|.::|:.:...::|...|
Zfish   267 KFS----HHLQPEDCL--STPADVITLDMVTIQVSDLERLKGEFTFTVEKSGMFHGFTVWFSAHF 325

  Fly   260 PSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAM 306
            .|.:...|:.|.|.|:|..|||:||:..||.|:.|...|.:.|.:.:
Zfish   326 QSLEDGPSIELNTGPYSEITHWKQTLFMLDAPVSVEEGDIIAGSIRL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 58/132 (44%)
prmt2NP_001073644.2 SH3_PRMT2 14..66 CDD:212740
PRMT5 <118..381 CDD:282971 91/265 (34%)
AdoMet_MTases 119..216 CDD:100107 48/99 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.