DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt9

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001124239.1 Gene:prmt9 / 553290 ZFINID:ZDB-GENE-080728-4 Length:859 Species:Danio rerio


Alignment Length:324 Identity:77/324 - (23%)
Similarity:146/324 - (45%) Gaps:69/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLEGKDSDYFQSYSRLET-HMNMLRDSVRMQAFRDAIVQ--DGGLFQDKIVLDVGCGTGILSLFA 72
            |.|.|::.|..:...:|. |..||.|..|...::.||.:  :||.   ..|||:|.|||||.:.|
Zfish   137 FPEAKENFYRVANWLVERWHFLMLNDHGRNHKYQLAIKKAVEGGC---SSVLDIGTGTGILGMCA 198

  Fly    73 AEAGASKVIAVECT-DIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGI-EKVDIIVSEWMGNA 135
            ..|||::|.|.|.: .:.::|.|::..|...:.:|::......:|:|..| .:|.::|:|.:...
Zfish   199 KMAGAAEVYACELSKTMYELACEVLSANGMADCIKILHRKSLDMEIPKDIPNRVSLVVTETVDAG 263

  Fly   136 LYMEAMINSVLFARDKWL-------------TRGGRILPSTGNLWLMGAYDP----HRRTNLNFW 183
            |:.|.:|.:::.|....|             ::.||::|:...::.:....|    |.|..::  
Zfish   264 LFGEGIIETLIHAWKHLLLPPPNPGELLSSPSQTGRVIPAGATVFGVAVQCPEIRRHHRLCVS-- 326

  Fly   184 CNVEGIDMGCVRKPFSQEPLVEFVPIQQLL-TDECFIHSTNLAVAR--------NQP-----VEF 234
             :|.|:|:..|.:.:|        |:..|. |::.....|...::|        .||     ::|
Zfish   327 -SVGGLDLSAVGQIYS--------PVSCLADTEDSTEPYTTERLSRLRGGYIQLTQPFTALDIDF 382

  Fly   235 QSNFQLK-------------VMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTV 285
            .:..:|:             |.:.||::.|.::|.:     ..::...|:|.|... |.|||.:
Zfish   383 NNVQELEGLCSREVVQLCLCVTQDGILDALAVWFQL-----HLDQDNHLSTGPQEE-TCWEQAI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 42/148 (28%)
prmt9NP_001124239.1 TPR_11 72..135 CDD:290150
TPR repeat 72..98 CDD:276809
MAS20 <96..133 CDD:295844
TPR repeat 103..133 CDD:276809
AdoMet_MTases 151..>267 CDD:302624 37/118 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.