DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT6

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:347 Identity:124/347 - (35%)
Similarity:184/347 - (53%) Gaps:45/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASK 79
            :|..|::.||.:..|..|:.|.||..|:|..|:::....:.|.|||||.||||||:|.|:|||.:
Human    43 RDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARR 107

  Fly    80 VIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINS 144
            |.|||.:.|...|.|::|.|..|:.|.|:.|.||.||||   |:||.|||||||..|..|:|::|
Human   108 VYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELP---EQVDAIVSEWMGYGLLHESMLSS 169

  Fly   145 VLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVE---GIDMGCVRKPFSQEPLV-- 204
            ||.||.|||..||.:||::..|::....|......|.||..|:   |:||.|: :.|:...|:  
Human   170 VLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCL-EGFATRCLMGH 233

  Fly   205 -EFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGI--------------------- 247
             |.| :|.|..::        .:||  |..|.   ||::.|.|:                     
Human   234 SEIV-VQGLSGED--------VLAR--PQRFA---QLELSRAGLEQELEAGVGGRFRCSCYGSAP 284

  Fly   248 INMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQD 312
            ::...::|.|.||.|:|.|.:.|:|||..|.|||:|.:|:|:||:.|.....|.|.:.:.|:..:
Human   285 MHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDN 349

  Fly   313 GRGMNFDLHISFRGERTRVESF 334
            .|.:...|......:..:.:.|
Human   350 PRRLRVLLRYKVGDQEEKTKDF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 67/131 (51%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
AdoMet_MTases 67..>200 CDD:418430 66/135 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1503
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.