DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt3

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001017655.1 Gene:prmt3 / 550348 ZFINID:ZDB-GENE-041105-1 Length:512 Species:Danio rerio


Alignment Length:312 Identity:114/312 - (36%)
Similarity:189/312 - (60%) Gaps:4/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77
            |.:|..||.||.....|..||:|.||.:::||.:.::..:|:||:||||||||||||:|||:|||
Zfish   195 EDEDEAYFSSYGHYSIHEEMLKDKVRTESYRDFMYRNMDVFKDKVVLDVGCGTGILSMFAAKAGA 259

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142
            .||:||:.::|...|.:|:|.|..|:.:.::||.:|:::||  :||||||:|||||..|...:|:
Zfish   260 KKVVAVDQSEIIYQAMDIVRSNNLEDTITLIKGRIEEIDLP--VEKVDIIISEWMGYFLLFGSML 322

  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTN-LNFWCNVEGIDMGCVRKPFSQEPLVEF 206
            :|||:|||::|...|.:.|...::.|....|..:..: :.||.:|.|..|.|::|....|.:||.
Zfish   323 DSVLYARDRYLADDGLVFPDRCSISLAAVGDTQKHNDRIAFWEDVYGFKMTCMKKAVIPEAVVEV 387

  Fly   207 VPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLT 271
            :..:.::::...|.:.:........:||..:|.||:..:.....:|.|||:.|.....|| |..:
Zfish   388 LKPETVISESAVIKTIDCGSVSVSELEFSVDFILKITASSFCTAIVGYFDIFFHKSCGNK-VMFS 451

  Fly   272 TSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHIS 323
            |:|:...|||:|||..|:.|:.|:..:.:.|.:::....:|.|.:...|:|:
Zfish   452 TAPNCTKTHWKQTVFLLESPVAVKAGEDLPGHISVRKNRKDPRALLITLNIA 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 65/131 (50%)
prmt3NP_001017655.1 zf-C2H2_2 39..>86 CDD:289522
Methyltransf_18 236..340 CDD:289607 56/105 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.