DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and PRMT7

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_011521414.1 Gene:PRMT7 / 54496 HGNCID:25557 Length:714 Species:Homo sapiens


Alignment Length:320 Identity:83/320 - (25%)
Similarity:138/320 - (43%) Gaps:52/320 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVR----MQAFRDAI--VQDGGLFQDKIVLDVGCGTGILSLF 71
            |.:..||.|..:| .::.:||.|..|    .|..|.|:  |:|.|  |..:|||:|.|||:||:.
Human    20 EDEHYDYHQEIAR-SSYADMLHDKDRNVKYYQGIRAAVSRVKDRG--QKALVLDIGTGTGLLSMM 81

  Fly    72 AAEAGASKVIAVEC-TDIADIAEEIIRDNQKENVVKVV-KGLVEQVELPDGIE--KVDIIVSEWM 132
            |..|||....|:|. ..:||.|.:|:..|...:.:||: |...|....|:|..  :.:|:|:|..
Human    82 AVTAGADFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVGPEGDMPCRANILVTELF 146

  Fly   133 GNALYMEAMINSVLFARDKWLTRGGRILP----------STGNLWLMGAYDP-HRRTNLNFWCNV 186
            ...|..|..:.|...|....:......:|          .:|.:|......| |.:|:|.....|
Human   147 DTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFPIHVQTSLGEQVIV 211

  Fly   187 EGIDM-GCVRKP------FSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMR 244
            ..:|: .|...|      .:|....:|.    :|:|...:.|.:.:...:......|. :.:.:.
Human   212 PPVDVESCPGAPSVCDIQLNQVSPADFT----VLSDVLPMFSIDFSKQVSSSAACHSR-RFEPLT 271

  Fly   245 TGIINMLVLYFDV-LFPSGKSNKSVSLTTSP---HS-----PW-THWEQTVLHL--DEPL 292
            :|...:::.::|: :.|.||    :..|.:|   ||     .| .||.|.|..|  :||:
Human   272 SGRAQVVLSWWDIEMDPEGK----IKCTMAPFWAHSDPEEMQWRDHWMQCVYFLPQEEPV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 44/141 (31%)
PRMT7XP_011521414.1 AdoMet_MTases 37..>186 CDD:302624 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.