DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt2

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001020315.1 Gene:Prmt2 / 499420 RGDID:1565519 Length:445 Species:Rattus norvegicus


Alignment Length:307 Identity:103/307 - (33%)
Similarity:159/307 - (51%) Gaps:18/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASK 79
            :|.:||.||..|:.|:.||.|..|...:...|:|:....:||::|||||||||:|||.|.....|
  Rat   110 QDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPK 174

  Fly    80 -VIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMIN 143
             |.|||.:|:|....:::..|...:.:.|.:..||.|.||   ||||::||||||..|..|.||.
  Rat   175 AVYAVEASDMAQHTGQLVLQNGFADTITVFQQKVEDVVLP---EKVDVLVSEWMGTCLLFEFMIE 236

  Fly   144 SVLFARDKWLTRGGRILPSTGNLWLM---GAYDPHRRTNLNFWCNVEGIDMG-----CVRKPFSQ 200
            |:|:|||.||...|.|.|:|..|.|:   ...|.|  :.:.||.|....::.     .:::.||:
  Rat   237 SILYARDAWLKEDGIIWPTTAALHLVPCSAEKDYH--SKVLFWDNAYEFNLSALKSLAIKEFFSR 299

  Fly   201 EPLVEFVPIQQLLTDECFIHSTNLAVARNQPVE-FQSNFQLKVMRTGIINMLVLYFDVLFPSGKS 264
            ......:..:..|::.|.|...::...:...:| .:...:..:.:.|.::....:|.|.|.|.:.
  Rat   300 PKSNHILKPEDCLSEPCTILQLDMRTVQVSDLETMRGELRFDIQKAGTLHGFTAWFSVHFQSLEE 364

  Fly   265 NKSVS-LTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRG--VLAMTP 308
            .:... |:|.|..|.|||:||:..:|:|:.|...|.|.|  ||...|
  Rat   365 GQPQQVLSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 59/132 (45%)
Prmt2NP_001020315.1 SH3_PRMT2 46..98 CDD:212740
AdoMet_MTases 153..253 CDD:100107 49/102 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.