DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and carm1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001003645.1 Gene:carm1 / 445251 ZFINID:ZDB-GENE-040724-77 Length:588 Species:Danio rerio


Alignment Length:332 Identity:113/332 - (34%)
Similarity:183/332 - (55%) Gaps:22/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77
            |.....|||.|..|....||::|.||...::.||:|:...|:||:|||||||:||||.|||:|||
Zfish   117 ESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKVVLDVGCGSGILSFFAAQAGA 181

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142
            .||.|||.:.:|..||.::..|:....|.|:.|.||:|.||   |:||||:||.||..|:.|.|:
Zfish   182 RKVYAVEASTMAQHAEVLVNSNRLSERVVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERML 243

  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYDP----HRRTNLNFWC--NVEGIDMGCVR----KP 197
            .|.|.|: |:|...|::.|:.|::.|....|.    .:.|..|||.  :..|:|:..:|    ..
Zfish   244 ESYLHAK-KFLKPSGKMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDE 307

  Fly   198 FSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRTGIINMLVLYFDVLFPS 261
            :.::|:|:...| ::|..:...::.|...|:.:.: :.:..|:..:|.:|:::.|..:|||.|..
Zfish   308 YFRQPIVDTFDI-RILMAKSVKYTVNFLEAKEEDLYKIEIPFKFHMMHSGLVHGLAFWFDVAFIG 371

  Fly   262 GKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRG 326
              |..:|.|:|:|..|.|||.|....|..||:.:..|.:.|...:..    .:..::|:.|..:.
Zfish   372 --SVMTVWLSTAPTEPLTHWYQVRCLLQSPLFAKAGDTMSGTALLIA----NKRQSYDISIVAQV 430

  Fly   327 ERTRVES 333
            ::|..:|
Zfish   431 DQTGSKS 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 63/131 (48%)
carm1NP_001003645.1 CARM1 8..112 CDD:288395
PRMT5 <146..409 CDD:282971 97/269 (36%)
AdoMet_MTases 162..263 CDD:100107 53/104 (51%)
Transactivation domain. /evidence=ECO:0000250 473..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.