DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Art9

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650321.1 Gene:Art9 / 41698 FlyBaseID:FBgn0038188 Length:313 Species:Drosophila melanogaster


Alignment Length:282 Identity:98/282 - (34%)
Similarity:165/282 - (58%) Gaps:12/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEI 95
            :||.|.:..:|:.....:...||:|||||||||.:|:|||.:.||||.||:|:...:.|:...:.
  Fly    14 SMLNDVISTRAYEWVFKRYERLFKDKIVLDVGCRSGLLSLMSVEAGAVKVMALGNRESAEFVSKA 78

  Fly    96 IRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRIL 160
            ....:||::.:.:.|.:.::.||.|::|||||||||:|::::::::...|:|||:|||.:||.|:
  Fly    79 FIGTEKEDIFEFIDGDIHEIVLPCGLKKVDIIVSEWVGHSVFVDSLFKEVIFAREKWLVKGGFII 143

  Fly   161 PSTGNLWLMGAYDPHRRT---NLNFWCNVEGIDMGCVRKPFSQEPLVE-FVPIQQLLTDECFIHS 221
            |:...|::.|..|..|:|   |:....:..|... .||:|.|   |:| :|..:||:|::..:.:
  Fly   144 PNVAQLFVCGIADHPRKTVEVNILPQSDYPGRSY-MVREPVS---LIEDYVAKEQLITEKYLLKT 204

  Fly   222 TNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDV--LFPSGKSNKSVSLTTSPHSPWTHWEQT 284
            .:|..|......|:..|:|:.:|...:..:|||.|:  ..|.||..  :..:|.|..|.|:..||
  Fly   205 IDLCTAHINDESFRVPFKLRGLRDSQLGAVVLYSDIGLCRPRGKFR--LMFSTGPKRPRTYVRQT 267

  Fly   285 VLHLDEPLYVRIRDRVRGVLAM 306
            :|.:|.|:.|...:.|.|.|.|
  Fly   268 ILFMDNPVEVAKCELVIGELGM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 53/129 (41%)
Art9NP_650321.1 AdoMet_MTases 41..143 CDD:100107 43/101 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.