DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and prmt7

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_956797.2 Gene:prmt7 / 393475 ZFINID:ZDB-GENE-040426-1560 Length:683 Species:Danio rerio


Alignment Length:322 Identity:84/322 - (26%)
Similarity:138/322 - (42%) Gaps:70/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAI------VQDGGLFQDKIVLDVGCGTGILSLF 71
            |.::.||.|..:| ..:.:||.|..|.:.:.:.|      |:..|  :..:|||:|.|||:||:.
Zfish    20 ESEEYDYHQEIAR-SCYADMLHDKDRNEKYYEGIRAAVRRVKARG--ERPVVLDIGTGTGLLSMM 81

  Fly    72 AAEAGASKVIAVEC-TDIADIAEEIIRDNQKENVVKVV-KGLVEQVELPDG--IEKVDIIVSEWM 132
            |..|||....|:|. ..:|..|..|:..|...:.:|:: |...|....|||  .|:.:|:|:|..
Zfish    82 AVTAGADFCYAIEVFKPMAQAASCIVERNGFSDKIKIINKHSTEVTVGPDGDMQERANILVTELF 146

  Fly   133 GNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRT---------NLNFWCNVEG 188
            ...|..|..:.|...|....:..|...:             |||.|         .|..|..:..
Zfish   147 DTELIGEGALPSYEHAHMHLVQTGCEAV-------------PHRATIYAQLVESDMLWKWAQMRP 198

  Fly   189 IDM--------GCVRKPFSQEPLVEFVPIQQLLTDE-------CFIHSTNL-----AVARNQPVE 233
            ||:        |.|:: .:..|.|..:.:.|:.||.       |.:.|.:.     :.|::..|.
Zfish   199 IDVDGHRLMPPGAVQE-CAGAPSVCDIQLSQVPTDAFTAISPVCTMFSVDFSKPVSSAAQSYTVR 262

  Fly   234 FQSNFQLKVMRTGIINMLVL-YFDV-LFPSGKSNKSVSLTTS---PHS-PW-THWEQTVLHL 288
            |:|       :||....:|| ::|: :.|.|....:::.:.|   ||: || .||.|:|..|
Zfish   263 FKS-------QTGGRAQVVLSWWDIDMDPEGNIVCTMAPSWSYADPHAYPWRDHWMQSVYFL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 41/141 (29%)
prmt7NP_956797.2 AdoMet_MTases 54..>189 CDD:302624 40/149 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.