DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Prmt8

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_958759.2 Gene:Prmt8 / 381813 MGIID:3043083 Length:394 Species:Mus musculus


Alignment Length:310 Identity:128/310 - (41%)
Similarity:206/310 - (66%) Gaps:5/310 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAV 83
            ||.||:....|..||:|.||...:|:::..:..:|:||:|||||.||||||:|||:|||.||..:
Mouse    76 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI 140

  Fly    84 ECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFA 148
            ||:.|:|.:|:||:.|..:||:.:.||.||:||||  :||||||:|||||..|:.|:|:|:|:||
Mouse   141 ECSSISDYSEKIIKANHLDNVITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFA 203

  Fly   149 RDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQL 212
            |||||..||.:.|....|:::...| .::...:::|.||.|.||.|:|....:||||:.|..:|:
Mouse   204 RDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQV 268

  Fly   213 LTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSP 277
            :|:.|.|...::...:.:.:.|.|.|.|::.|...::.||.||::.|.  |.:|.:..:|:|.:|
Mouse   269 VTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFT--KCHKKMGFSTAPDAP 331

  Fly   278 WTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGE 327
            :|||:|||.:|::.|.||..:.:.|.::|.|..::.|.::|.:.:.|:|:
Mouse   332 YTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 72/131 (55%)
Prmt8NP_958759.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..40
SH3-binding 1. /evidence=ECO:0000250|UniProtKB:Q9NR22 29..42
SH3-binding 2. /evidence=ECO:0000250|UniProtKB:Q9NR22 53..58
AdoMet_MTases 115..215 CDD:100107 62/101 (61%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q9NR22 119..122 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.