DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Art7

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster


Alignment Length:345 Identity:81/345 - (23%)
Similarity:141/345 - (40%) Gaps:95/345 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKDSDYFQSYSRLETHM--------NMLRDSVRMQAFRDAI------VQDGGLFQDKIVLDVGCG 64
            |.|.||         |:        :||.|..|.|.:..|:      :::.|  ::..|||:|.|
  Fly    21 GDDYDY---------HLEVANAGFGDMLHDWERNQKYFAALRKTIAGMREAG--REVHVLDIGTG 74

  Fly    65 TGILSLFAAEAGASKVIAVEC-TDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGI-EKVDII 127
            |||||:.|..|||..|.|.|. ..:|:.||:|:..|...:.|::::....::::.:.: .|.:::
  Fly    75 TGILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLL 139

  Fly   128 VSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDP--HRRTNLNFWCNVEGID 190
            |:|.:...|..|..|.....|..:.||.....:|:....:...|..|  .:..:|....|::|  
  Fly   140 VAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLAAQWNSLKTIANLDG-- 202

  Fly   191 MGCVRKPFSQEPLVEFVPIQQLLT--DECFIHSTNLAVARN-------QPVE-FQSNFQLKVMR- 244
                      |||:.  |.:||.:  .|..:|...|:...:       .||| ||.:||.|..| 
  Fly   203 ----------EPLLH--PPEQLKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQERE 255

  Fly   245 -------------TGIINMLVLYFDV-LFPSGKSNKSVSLTTSPH-------------------- 275
                         .|...::..::|: |...|:    :.|:.:|:                    
  Fly   256 KQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGE----ILLSCAPYWAHPQLKELAAEKAKDHPLP 316

  Fly   276 --SPW-THWEQTVLHLDEPL 292
              .|| .||.|.:.::.:||
  Fly   317 NVVPWRDHWMQAIYYIPKPL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 40/147 (27%)
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.