DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Bud23

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001129215.1 Gene:Bud23 / 368084 RGDID:1589742 Length:281 Species:Rattus norvegicus


Alignment Length:223 Identity:44/223 - (19%)
Similarity:72/223 - (32%) Gaps:86/223 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELP 118
            |...:||:|||:|:...:.:|.|                                          
  Rat    53 QPSYLLDIGCGSGLSGDYISEEG------------------------------------------ 75

  Fly   119 DGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFW 183
                      ..|:|..: ..||:::.| .||   |.|..:|..      ||...|.|..:.:..
  Rat    76 ----------HYWVGIDI-SPAMLDAAL-DRD---TEGDLLLGD------MGQGVPFRPGSFDGC 119

  Fly   184 CNVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQ----SNFQLKVM- 243
            .::..:...|.....|.      :|.::|.   ||..|...|:.|......|    ::.||::: 
  Rat   120 ISISAVQWLCNANKKSD------IPARRLY---CFFSSLYSALVRGARAVLQLYPENSEQLELIT 175

  Fly   244 ----RTGIINMLVLYFDVLFP-SGKSNK 266
                |.|....:|    |.|| |.|:.|
  Rat   176 TQATRAGFTGGVV----VDFPNSAKAKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 18/106 (17%)
Bud23NP_001129215.1 UbiG 18..>91 CDD:225137 13/90 (14%)
Methyltransf_11 58..>128 CDD:400514 22/132 (17%)
WBS_methylT 204..279 CDD:403702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.