DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Alkbh8

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001178838.1 Gene:Alkbh8 / 366783 RGDID:1304687 Length:664 Species:Rattus norvegicus


Alignment Length:286 Identity:54/286 - (18%)
Similarity:100/286 - (34%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LEGKDSDYFQSYSRLETHMNMLRDS--VRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAE 74
            ||.:.......|..:.:|.:..|.|  .|:..|..|      |....||.|:|||.|      ..
  Rat   368 LELEQKHVHHVYDEIASHFSSTRHSPWPRIVEFLKA------LPSGSIVADIGCGNG------KY 420

  Fly    75 AGASKVIAVECTDIADIAEEIIRDNQKENVV-------------------KVVKGLVEQVELPDG 120
            .|.:|.:.:...|.:....:|.|:.|.:.:|                   .|:..........:.
  Rat   421 LGINKELYMIGCDRSRNLVDICRERQFQALVCDALAVPVRSGSCDACISIAVIHHFATAERRVEA 485

  Fly   121 IEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCN 185
            ::::..::.......:|:.||.......:.|:| :|.||  |.|:           :..||...:
  Rat   486 LQEIARLLRSGGQALIYVWAMEQEYRDQKSKYL-KGNRI--SQGD-----------KGELNSATS 536

  Fly   186 VEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINM 250
            :|.:.:..:.:..|::|.:..........:||          :::.| ..|...:...||...:.
  Rat   537 MEQLLVNQMPEGVSEDPGLSVHSSNNTKDEEC----------KSRKV-LNSELPIHTNRTCFHSQ 590

  Fly   251 LVLYFDVLFP---SGKSNKSVSLTTS 273
                 |||.|   .||..|..::..|
  Rat   591 -----DVLVPWHLKGKPGKDKAVEQS 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 30/152 (20%)
Alkbh8NP_001178838.1 DUF1891 1..37 CDD:117570
RRM_ALKBH8 42..122 CDD:240877
2OG-FeII_Oxy 152..334 CDD:304390
Methyltransf_11 412..501 CDD:285453 13/94 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.