DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and CG8067

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster


Alignment Length:129 Identity:32/129 - (24%)
Similarity:55/129 - (42%) Gaps:38/129 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RDSVRMQAFRDAIVQDGGLF--------------------QDKIVLDVGCGTGILSL-FAAEAGA 77
            |::.|:|..|.|:.:|.||:                    :.|...|:||..|.||. ..||   
  Fly    33 RNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSRHILAE--- 94

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLV---EQVELPDGIEKVDIIVS----EWMGN 134
                :||...:.|.:..::...|....:|:|| ||   ||::..|  ..:|:::|    .|:.:
  Fly    95 ----SVEQLTLTDTSATMLEQAQGTPGLKMVK-LVKDEEQLDFED--NSLDLVISSLSLHWVND 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 32/129 (25%)
CG8067NP_001260960.1 BioC 58..296 CDD:273953 24/104 (23%)
Methyltransf_11 79..170 CDD:285453 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.