DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art6 and Carm1

DIOPT Version :9

Sequence 1:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001025212.1 Gene:Carm1 / 363026 RGDID:1305879 Length:608 Species:Rattus norvegicus


Alignment Length:332 Identity:110/332 - (33%)
Similarity:180/332 - (54%) Gaps:22/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77
            |.....|||.|..|....||::|.||...::.||:|:...|:||||||||||:||||.|||:|||
  Rat   144 ESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGA 208

  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142
            .|:.|||.:.:|..||.:::.|...:.:.|:.|.||:|.||   |:||||:||.||..|:.|.|:
  Rat   209 RKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERML 270

  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYDP----HRRTNLNFWC--NVEGIDMGCVR----KP 197
            .|.|.|: |:|...|.:.|:.|::.|....|.    .:.|..|||.  :..|:|:..:|    ..
  Rat   271 ESYLHAK-KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDE 334

  Fly   198 FSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPV-EFQSNFQLKVMRTGIINMLVLYFDVLFPS 261
            :.::|:|:...| ::|..:...::.|...|:...: ..:..|:..::.:|:::.|..:|||.|..
  Rat   335 YFRQPVVDTFDI-RILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIG 398

  Fly   262 GKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRG 326
              |..:|.|:|:|..|.|||.|.......||:.:..|.:.|...:..    .:..::|:.|..:.
  Rat   399 --SIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIA----NKRQSYDISIVAQV 457

  Fly   327 ERTRVES 333
            ::|..:|
  Rat   458 DQTGSKS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 62/131 (47%)
Carm1NP_001025212.1 CARM1 35..139 CDD:402914
AdoMet_MTases 189..284 CDD:100107 49/98 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.